PDB entry 2r2p

View 2r2p on RCSB PDB site
Description: Kinase domain of human ephrin type-A receptor 5 (EphA5)
Class: transferase
Keywords: ATP-BINDING, KINASE, NUCLEOTIDE-BINDING, RECEPTOR, SIGNAL, TRANSFERASE, PHOSPHORYLATION, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE, Alternative splicing, Glycoprotein, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-08-27, released 2007-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA5, EHK1, HEK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54756 (Start-287)
      • expression tag (288-294)
    Domains in SCOPe 2.05: d2r2pa_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r2pA (A:)
    mphtyedpnqavhefakeieascitiervigagefgevcsgrlklpgkrelpvaiktlkv
    gytekqrrdflgeasimgqfdhpniihlegvvtkskpvmivteymengsldtflkkndgq
    ftviqlvgmlrgisagmkylsdmgyvhrdlaarnilinsnlvckvsdfglsrvleddpea
    ayttrggkipirwtapeaiafrkftsasdvwsygivmwevvsygerpywemtnqdvikav
    eegyrlpspmdcpaalyqlmldcwqkernsrpkfdeivnmldklirnpahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r2pA (A:)
    avhefakeieascitiervigagefgevcsgrlklpgkrelpvaiktlkvgytekqrrdf
    lgeasimgqfdhpniihlegvvtkskpvmivteymengsldtflkkndgqftviqlvgml
    rgisagmkylsdmgyvhrdlaarnilinsnlvckvsdfglsrvleddpaayttrgkipir
    wtapeaiafrkftsasdvwsygivmwevvsygerpywemtnqdvikaveegyrlpspmdc
    paalyqlmldcwqkernsrpkfdeivnmldklirnpahhhhhh