PDB entry 2r2l

View 2r2l on RCSB PDB site
Description: Structure of Farnesyl Protein Transferase bound to PB-93
Class: transferase
Keywords: Malaria, FPT, Transferase, Metal-binding, Phosphorylation, Prenyltransferase, Zinc
Deposited on 2007-08-27, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyltransferase subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r2la_
  • Chain 'B':
    Compound: Farnesyltransferase subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fntb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r2lb_
  • Heterogens: ZN, FPP, PB9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r2lA (A:)
    gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
    erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
    vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
    nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
    nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
    eywryigrslqskhs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r2lB (B:)
    lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
    krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
    gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
    saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
    kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
    lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
    hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf