PDB entry 2r2k

View 2r2k on RCSB PDB site
Description: crystal structure of the complex of camel peptidoglycan recognition protein with disaccharide at 3.2a resolution
Deposited on 2007-08-26, released 2007-09-18
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peptidoglycan recognition protein
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Peptidoglycan recognition protein
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Peptidoglycan recognition protein
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TLA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2r2kA (A:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2r2kB (B:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2r2kC (C:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2r2kD (D:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra