PDB entry 2r29

View 2r29 on RCSB PDB site
Description: Neutralization of dengue virus by a serotype cross-reactive antibody elucidated by cryoelectron microscopy and x-ray crystallography
Class: Viral protein/Immune system
Keywords: Fab-antigen complex, ATP-binding, Capsid protein, Cleavage on pair of basic residues, Endoplasmic reticulum, Envelope protein, Glycoprotein, Helicase, Hydrolase, Membrane, Metal-binding, Multifunctional enzyme, Nucleotide-binding, Nucleotidyltransferase, Nucleus, Phosphorylation, Protease, Ribonucleoprotein, RNA replication, RNA-binding, RNA-directed RNA polymerase, Secreted, Serine protease, Transcription, Transcription regulation, Transferase, Transmembrane, Viral nucleoprotein, Virion, Viral protein/Immune system COMPLEX
Deposited on 2007-08-24, released 2007-12-25
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-25, with a file datestamp of 2008-03-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.259
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus type 2
    Gene: E protein
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r29a1
  • Chain 'H':
    Compound: Heavy chain of Fab 1A1D-2
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2R29 (0-215)
  • Chain 'L':
    Compound: Light chain of Fab 1A1D-2
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2R29 (0-216)
    Domains in SCOP 1.75: d2r29l1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r29A (A:)
    sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
    vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2r29L (L:)
    divltqspaslavslgqratiscrasesvvrygnsfmhwyqqkpgqppklliyrassles
    giptrfsgsgsrtdftltinpveaddvatyycqqtnvdpwafgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r29L (L:)
    divltqspaslavslgqratiscrasesvvrygnsfmhwyqqkpgqppklliyrassles
    giptrfsgsgsrtdftltinpveaddvatyycqqtnvdpwafgggtkleikradaaptvs
    ifppssltsggasvvcflnnfypkdinvkwkidrqngvlnswtdqdstysmsstltltkd
    eyerhnsytceatspivksfnrne