PDB entry 2r23

View 2r23 on RCSB PDB site
Description: Crystal structure of S25-2 Fab in complex with Kdo analogues
Class: immune system
Keywords: Fab, anti-carbohydrate antibody, IMMUNE SYSTEM
Deposited on 2007-08-24, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.23
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab, antibody fragment (IgG1k), light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2R23 (0-218)
    Domains in SCOPe 2.07: d2r23a1, d2r23a2
  • Chain 'B':
    Compound: Fab, antibody fragment (IgG1k), heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2R23 (0-223)
    Domains in SCOPe 2.07: d2r23b1, d2r23b2
  • Heterogens: MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r23A (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r23A (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgsergvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r23B (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r23B (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc