PDB entry 2r1y

View 2r1y on RCSB PDB site
Description: Crystal structure of S25-2 Fab in complex with Kdo analogues
Class: immune system
Keywords: Fab, anti-carbohydrate antibody, IMMUNE SYSTEM
Deposited on 2007-08-23, released 2008-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-12-30, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.23
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab, antibody fragment (IgG1k), light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2R1Y (0-218)
    Domains in SCOPe 2.05: d2r1ya1, d2r1ya2
  • Chain 'B':
    Compound: Fab, antibody fragment (IgG1k), heavy chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 2R1Y (0-221)
    Domains in SCOPe 2.05: d2r1yb1, d2r1yb2
  • Heterogens: KDO, MG, ZN, KDR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r1yA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r1yA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgsergvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r1yB (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r1yB (B:)
    evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
    eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
    saakttppsvyplapnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivpr