PDB entry 2r1m

View 2r1m on RCSB PDB site
Description: OpdA from Agrobacterium radiobacter with bound product diethyl phosphate from crystal soaking with diethyl 4-methoxyphenyl phosphate (450h)- 2.5 A
Class: hydrolase
Keywords: phosphotriesterase, opda, metalloenzyme, HYDROLASE
Deposited on 2007-08-23, released 2008-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.159
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-327)
      • engineered (58)
      • engineered (231)
    Domains in SCOPe 2.08: d2r1ma_
  • Heterogens: FE2, CO, DPF, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1mA (A:)
    gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharaa
    gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre
    iqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalfg
    trswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi
    pflrekgvppetlagvtvanparflspt