PDB entry 2r1k

View 2r1k on RCSB PDB site
Description: OpdA from Agrobacterium radiobacter with bound diethyl phosphate from crystal soaking with the compound- 1.9 A
Class: hydrolase
Keywords: phosphotriesterase, opda, metalloenzyme, HYDROLASE
Deposited on 2007-08-23, released 2008-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.156
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-328)
      • engineered (59)
      • engineered (232)
    Domains in SCOPe 2.08: d2r1ka_
  • Heterogens: FE2, CO, DPF, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1kA (A:)
    tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara
    agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
    eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
    aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalf
    gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
    ipflrekgvppetlagvtvanparflspt