PDB entry 2r1j

View 2r1j on RCSB PDB site
Description: Crystal Structure of the P22 c2 Repressor protein in complex with the synthetic operator 9T
Class: transcription/DNA
Keywords: Protein-DNA complex, Helix-turn-helix, DNA-binding, Repressor, Transcription, Transcription regulation, TRANSCRIPTION/DNA COMPLEX
Deposited on 2007-08-22, released 2008-04-29
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-29, with a file datestamp of 2008-04-25.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.204
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*dtp*dap*dtp*dtp*dtp*dap*dap*dgp*dap*dtp*dap*dtp*dcp*dtp*dtp*dap*dap*dap*dtp*dg)-3'
  • Chain 'B':
    Compound: 5'-d(*dcp*dap*dtp*dtp*dtp*dap*dap*dgp*dap*dtp*dap*dtp*dcp*dtp*dtp*dap*dap*dap*dtp*da)-3'
  • Chain 'L':
    Compound: Repressor protein C2
    Species: Bacteriophage P22
    Gene: c2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r1jl1
  • Chain 'R':
    Compound: Repressor protein C2
    Species: Bacteriophage P22
    Gene: c2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r1jr1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >2r1jL (L:)
mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs
pdyllkgd

    Sequence, based on observed residues (ATOM records): (download) 
    >2r1jL (L:)
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd

  • Chain 'R':
    Sequence, based on SEQRES records: (download) 
    >2r1jR (R:)
mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs
pdyllkgd

    Sequence, based on observed residues (ATOM records): (download) 
    >2r1jR (R:)
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd