PDB entry 2r1h

View 2r1h on RCSB PDB site
Description: met-Trout IV hemoglobin at pH 6.3
Class: oxygen binding
Keywords: trout hemoglobin, autoxidation, hemin loss, heme pocket, Iron, Metal-binding, Oxygen transport, Transport, OXYGEN BINDING
Deposited on 2007-08-22, released 2008-09-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r1ha_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02141 (0-146)
      • conflict (5)
      • conflict (85-86)
      • conflict (96)
    Domains in SCOPe 2.04: d2r1hb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r1hc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-4
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02141 (0-146)
      • conflict (5)
      • conflict (85-86)
      • conflict (96)
    Domains in SCOPe 2.04: d2r1hd_
  • Heterogens: HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1hA (A:)
    slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg
    itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp
    eihlsvdkflqqlalalaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1hB (B:)
    vdwtdaersaivglwgkisvdeigpqalarllivspwtqrhfstfgnlstpaaimgnpav
    akhgktvmhgldravqnlddikntyvtlsvmhseklfvdpdnfrlladcitvcvaaklgp
    avfsadtqeafqkflavvvsalgrqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1hC (C:)
    slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg
    itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp
    eihlsvdkflqqlalalaekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1hD (D:)
    vdwtdaersaivglwgkisvdeigpqalarllivspwtqrhfstfgnlstpaaimgnpav
    akhgktvmhgldravqnlddikntyvtlsvmhseklfvdpdnfrlladcitvcvaaklgp
    avfsadtqeafqkflavvvsalgrqyh