PDB entry 2r1c

View 2r1c on RCSB PDB site
Description: Coordinates of the thermus thermophilus ribosome binding factor A (RbfA) homology model as fitted into the CRYO-EM map of a 30S-RBFA complex
Class: RNA binding protein
Keywords: helix-kink-helix, KH domain, rRNA processing, RNA BINDING PROTEIN
Deposited on 2007-08-22, released 2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: EM
Resolution: 12.5 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosome-binding factor a
  Species: Thermus thermophilus [TaxId:300852]
  Gene: TTHA0907
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJV1 (Start-94)
  Domains in SCOPe 2.08: d2r1ca1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2r1cA (A:)
  maygkahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalr
  alsraerrlvaalarrvrmrrlprleflpwraspa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2r1cA (A:)
  kahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalralsr
  aerrlvaalarrvrmrrlprleflpwraspa