PDB entry 2r13

View 2r13 on RCSB PDB site
Description: Crystal structure of human mitoNEET reveals a novel [2Fe-2S] cluster coordination
Class: metal binding protein
Keywords: beta-beta-alpha-beta topology, Acetylation, Metal-binding, Zinc, Zinc-finger, METAL BINDING PROTEIN
Deposited on 2007-08-22, released 2007-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger CDGSH domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ45 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d2r13a1, d2r13a2
  • Heterogens: CL, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r13A (A:)
    snarfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtk
    hneetgdnvgpliikkket
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r13A (A:)
    snarfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtk
    hneetgdnvgpliikk