PDB entry 2r0x

View 2r0x on RCSB PDB site
Description: Crystal structure of a putative flavin reductase (ycdh, hs_1225) from haemophilus somnus 129pt at 1.06 A resolution
Class: oxidoreductase
Keywords: Split barrel-like, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, oxidoreductase
Deposited on 2007-08-21, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Possible flavin reductase
    Species: Histophilus somni [TaxId:205914]
    Gene: YP_719437.1, ycdH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0I3S1 (11-157)
      • leader sequence (2-10)
    Domains in SCOPe 2.08: d2r0xa1, d2r0xa2
  • Heterogens: ACT, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0xA (A:)
    gmvevsqfkdamaqlasavhivttsgetgqhgftasavcsvtdspptllvcinsnaraye
    hfvknrvlmvntltaeqsslsnifasplsqeerfsnaswttlttgspmlqdalinfdcei
    teikhvgthdilickivdihqsnaknalvyrnrvyhsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0xA (A:)
    vevsqfkdamaqlasavhivttsgetgqhgftasavcsvtdspptllvcinsnarayehf
    vknrvlmvntltaeqsslsnifasplsqeerfsnaswttlttgspmlqdalinfdceite
    ikhvgthdilickivdihqsnaknalvyrnrvyhsv