PDB entry 2r0u

View 2r0u on RCSB PDB site
Description: Crystal Structure of Chek1 in Complex with Inhibitor 54
Class: transferase
Keywords: Chek1, Kinase, cell cycle check point, ATP-binding, Cytoplasm, DNA damage, DNA repair, Nucleotide-binding, Nucleus, Phosphorylation, Polymorphism, Serine/threonine-protein kinase, Transferase, Ubl conjugation
Deposited on 2007-08-21, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r0ua_
  • Heterogens: M54, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0uA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgfskhiqsnldf
    spvnsasrtpgsgwskehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0uA (A:)
    avpfvedwdlvqtlgegevqlavnrvteeavavkivdmknikkeicinkmlnhenvvkfy
    ghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdi
    kpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdv
    wscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenps
    aritipdikkdrwynkplkkgakrprvts