PDB entry 2r0t

View 2r0t on RCSB PDB site
Description: Crystal structure of GDP-4-keto-6-deoxymannose-3-dehydratase with a trapped PLP-glutamate geminal diamine
Class: transferase
Keywords: colitose, aspartate aminotransferase, geminal diamine, pyridoxal phosphate, TRANSFERASE
Deposited on 2007-08-21, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxamine 5-phosphate-dependent dehydrase
    Species: Escherichia coli [TaxId:562]
    Gene: wbdK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F118 (Start-389)
      • engineered (189)
    Domains in SCOPe 2.08: d2r0ta_
  • Chain 'B':
    Compound: Pyridoxamine 5-phosphate-dependent dehydrase
    Species: Escherichia coli [TaxId:562]
    Gene: wbdK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F118 (Start-389)
      • engineered (189)
    Domains in SCOPe 2.08: d2r0tb_
  • Heterogens: PGU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0tA (A:)
    ghminyplasstwddleykaiqsvldskmftmgeyvkqyetqfaktfgskyavmvssgst
    anllmiaalfftkkprlkkgdeiivpavswsttyyplqqyglrvkfvdidintlnidies
    lkeavtdstkailtvnllgnpnnfdeinkiiggrdiilledncesmgatfnnkcagtfgl
    mgtfssfyskhiatmeggcivtddeeiyhillcirahgwtrnlpkknkvtgvksddqfee
    sfkfvlpgynvrplemsgaigieqlkklprfisvrrknaeyfldkfkdhpyldvqqetge
    sswfgfsfiikkdsgvirkqlvenlnsagiecrpivtgnflkntdvlkyfdytvhnnvdn
    aeyldknglfvgnhqielfdeidylrevlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0tA (A:)
    nyplasstwddleykaiqsvldskmftmgeyvkqyetqfaktfgskyavmvssgstanll
    miaalfftkkprlkkgdeiivpavswsttyyplqqyglrvkfvdidintlnidieslkea
    vtdstkailtvnllgnpnnfdeinkiiggrdiilledncesmgatfnnkcagtfglmgtf
    ssfyskhiatmeggcivtddeeiyhillcirahgwtrnlpkknkvtgvksddqfeesfkf
    vlpgynvrplemsgaigieqlkklprfisvrrknaeyfldkfkdhpyldvqqetgesswf
    gfsfiikkdsgvirkqlvenlnsagiecrpivtgnflkntdvlkyfdytvhnnvdnaeyl
    dknglfvgnhqielfdeidylrevlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r0tB (B:)
    ghminyplasstwddleykaiqsvldskmftmgeyvkqyetqfaktfgskyavmvssgst
    anllmiaalfftkkprlkkgdeiivpavswsttyyplqqyglrvkfvdidintlnidies
    lkeavtdstkailtvnllgnpnnfdeinkiiggrdiilledncesmgatfnnkcagtfgl
    mgtfssfyskhiatmeggcivtddeeiyhillcirahgwtrnlpkknkvtgvksddqfee
    sfkfvlpgynvrplemsgaigieqlkklprfisvrrknaeyfldkfkdhpyldvqqetge
    sswfgfsfiikkdsgvirkqlvenlnsagiecrpivtgnflkntdvlkyfdytvhnnvdn
    aeyldknglfvgnhqielfdeidylrevlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0tB (B:)
    nyplasstwddleykaiqsvldskmftmgeyvkqyetqfaktfgskyavmvssgstanll
    miaalfftkkprlkkgdeiivpavswsttyyplqqyglrvkfvdidintlnidieslkea
    vtdstkailtvnllgnpnnfdeinkiiggrdiilledncesmgatfnnkcagtfglmgtf
    ssfyskhiatmeggcivtddeeiyhillcirahgwtrnlpkknkvtgvksddqfeesfkf
    vlpgynvrplemsgaigieqlkklprfisvrrknaeyfldkfkdhpyldvqqetgesswf
    gfsfiikkdsgvirkqlvenlnsagiecrpivtgnflkntdvlkyfdytvhnnvdnaeyl
    dknglfvgnhqielfdeidylrevlk