PDB entry 2r0s

View 2r0s on RCSB PDB site
Description: crystal structure of the rsc4 tandem bromodomain
Deposited on 2007-08-21, released 2007-10-30
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromatin structure-remodeling complex protein RSC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RSC4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2r0sA (A:)
    vdynaplnpkselflddwhipkfnrfisftldvlidkykdifkdfiklpsrkfhpqyyyk
    iqqpmsineiksrdyeyedgpsnflldvelltkncqayneydslivknsmqvvmliefev
    lkaknlkrnylinsevkakllhylnklvdatekkinqallgasspknlddkvklsepfme
    lvdkdelpeyyeivhspmalsivkqnleigqyskiydfiidmllvfqnahifndpsaliy
    kdattltnyfnyliqkeffpelqdlnergeinlefdkfefenyla