PDB entry 2r0r

View 2r0r on RCSB PDB site
Description: Crystal Structure of Human Saposin D variant SapD K9E
Class: lipid binding protein
Keywords: lipid binding protein, saposin, activator protein, sap, Alternative splicing, Disease mutation, Gaucher disease, Glycoprotein, GM2-gangliosidosis, Lipid metabolism, Lysosome, Metachromatic leukodystrophy, Sphingolipid metabolism
Deposited on 2007-08-21, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proactivator polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAP, GLBA, SAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07602 (1-End)
      • engineered (7)
    Domains in SCOPe 2.08: d2r0ra_
  • Chain 'B':
    Compound: Proactivator polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAP, GLBA, SAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07602 (1-End)
      • expression tag (0)
      • engineered (7)
    Domains in SCOPe 2.08: d2r0rb1, d2r0rb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2r0rA (A:)
agfcevceklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvliei
lvevmdpsfvclkigacpshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2r0rA (A:)
gfcevceklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlieil
vevmdpsfvclkigacp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2r0rB (B:)
agfcevceklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvliei
lvevmdpsfvclkigacpshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2r0rB (B:)
agfcevceklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvliei
lvevmdpsfvclkigacp