PDB entry 2r0m

View 2r0m on RCSB PDB site
Description: The effect of a Glu370Asp Mutation in Glutaryl-CoA Dehydrogenase on Proton Transfer to the Dienolate Intermediate
Class: oxidoreductase
Keywords: Glutaryl-CoA Dehydrogenase, Flavoprotein, isomerase, Alternative splicing, Disease mutation, FAD, Mitochondrion, Oxidoreductase, Polymorphism, Transit peptide
Deposited on 2007-08-20, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.191
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92947
      • engineered (369)
    Domains in SCOPe 2.07: d2r0ma1, d2r0ma2
  • Heterogens: FAD, 4NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0mA (A:)
    rpefdwqdplvleeqlttdeilirdtfrtycqerlmprillanrnevfhreiisemgelg
    vlgptikgygcagvssvaygllarelervdsgyrsamsvqsslvmhpiyaygseeqrqky
    lpqlakgellgcfgltepnsgsdpssmetrahynssnksytlngtktwitnspmadlfvv
    warcedgcirgfllekgmrglsapriqgkfslrasatgmiimdgvevpeenvlpgasslg
    gpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlteit
    lglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvirha
    mnleavntydgthdihalilgraitgiqaftask
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0mA (A:)
    efdwqdplvleeqlttdeilirdtfrtycqerlmprillanrnevfhreiisemgelgvl
    gptikgygcagvssvaygllarelervdsgyrsamsvqsslvmhpiyaygseeqrqkylp
    qlakgellgcfgltepnsgsdpssmetrahynssnksytlngtktwitnspmadlfvvwa
    rcedgcirgfllekgmrglsapriqgkfslrasatgmiimdgvevpeenvlpgasslggp
    fgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlteitlg
    lhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvirhamn
    leavntydgthdihalilgraitgiqafta