PDB entry 2r0l

View 2r0l on RCSB PDB site
Description: Short Form HGFA with Inhibitory Fab75
Class: hydrolase, immune system
Keywords: serine protease, antibody, allosteric inhibitor, EGF-like domain, Glycoprotein, Hydrolase, Kringle, Secreted, Zymogen, IMMUNE SYSTEM
Deposited on 2007-08-20, released 2007-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor activator
    Species: Homo sapiens [TaxId:9606]
    Gene: HGFAC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hepatocyte growth factor activator
    Species: Homo sapiens [TaxId:9606]
    Gene: HGFAC
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: antibody heavy chain, Fab portion only
    Species: Homo sapiens, synthetic construct, synthetic [TaxId:9606, 32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R0L (0-219)
    Domains in SCOPe 2.08: d2r0lh1, d2r0lh2
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Homo sapiens, synthetic construct, synthetic [TaxId:9606, 32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R0L (0-213)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r0lH (H:)
    evqlvesggglvqpggslrlscaasgftisnsgihwvrqapgkglewvgwiyptggatdy
    adsvkgrftisadtskntaylqmnslraedtavyycarfwwrsfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    No sequence available.