PDB entry 2r0j

View 2r0j on RCSB PDB site
Description: Crystal structure of the putative ubiquitin conjugating enzyme, PFE1350c, from Plasmodium falciparum
Class: ligase
Keywords: ubiquitin conjugating, malaria, Plasmodium falciparum, Ligase, Ubl conjugation pathway, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-08-20, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carrier protein
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFE1350c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r0ja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2r0jA (A:)
giprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqy
pmeppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepddpld
skvaehfkqdkndaehvarqwnkiyannn

    Sequence, based on observed residues (ATOM records): (download) 
    >2r0jA (A:)
iprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqyp
meppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepddplds
kvaehfkqdkndaehvarqwnkiyann