PDB entry 2r0h

View 2r0h on RCSB PDB site
Description: Fungal lectin CGL3 in complex with chitotriose (chitotetraose)
Class: sugar binding protein
Keywords: galectin-related, lectin, sugar binding protein, chitotriose, chitooligosaccharides
Deposited on 2007-08-20, released 2008-05-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CGL3 lectin
    Species: Coprinus cinereus
    Gene: cgl3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r0ha_
  • Chain 'B':
    Compound: CGL3 lectin
    Species: Coprinus cinereus
    Gene: cgl3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r0hb_
  • Chain 'C':
    Compound: CGL3 lectin
    Species: Coprinus cinereus
    Gene: cgl3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r0hc_
  • Chain 'D':
    Compound: CGL3 lectin
    Species: Coprinus cinereus
    Gene: cgl3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2r0hd_
  • Heterogens: CTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0hA (A:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpran
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0hA (A:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r0hB (B:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpran
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0hB (B:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r0hC (C:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpran
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0hC (C:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2r0hD (D:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpran
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0hD (D:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanv