PDB entry 2r0f

View 2r0f on RCSB PDB site
Description: Ligand free structure of fungal lectin CGL3
Class: sugar binding protein
Keywords: galectin-related, lectin, sugar binding protein, chitooligosaccharides
Deposited on 2007-08-19, released 2008-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.243
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CGL3 lectin
    Species: Coprinus cinereus
    Gene: cgl3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r0fa_
  • Chain 'B':
    Compound: CGL3 lectin
    Species: Coprinus cinereus
    Gene: cgl3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2r0fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0fA (A:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpran
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0fA (A:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r0fB (B:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpran
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0fB (B:)
    mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
    igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
    yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpra