PDB entry 2r0d

View 2r0d on RCSB PDB site
Description: Crystal Structure of Autoinhibited Form of Grp1 Arf GTPase Exchange Factor
Class: signaling protein
Keywords: Grp1, General Receptor for Phosphoinositides, Arf GTPase, exchange factor, PIP3, 3-phosphoinositide, Guanine-nucleotide releasing factor, SIGNALING PROTEIN
Deposited on 2007-08-18, released 2007-12-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytohesin-3
    Species: Mus musculus [TaxId:10090]
    Gene: Pscd3, Grp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08967 (10-End)
      • expression tag (1-9)
      • engineered (15)
    Domains in SCOPe 2.04: d2r0da1, d2r0da2
  • Chain 'B':
    Compound: Cytohesin-3
    Species: Mus musculus [TaxId:10090]
    Gene: Pscd3, Grp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08967 (10-End)
      • expression tag (1-9)
      • engineered (15)
    Domains in SCOPe 2.04: d2r0db1, d2r0db2
  • Heterogens: SO4, 4IP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0dA (A:)
    mghhhhhhgsttqrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgegln
    ktvigdylgerddfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeaf
    asryclcnpgvfqstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlp
    eellrnlyesiknepfkipeddgndlthtffnpdregwllklggrvktwkrrwfiltdnc
    lyyfeyttdkeprgiiplenlsirevedprkpncfelynpshkgqvikackteadgrvve
    gnhvvyrisapspeekeewmksikasisrdpfydmlatrkrriankk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0dA (A:)
    ghhhhhhgsttqrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgeglnk
    tvigdylgerddfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeafa
    sryclcnpgvfqstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlpe
    ellrnlyesiknepfkipeddgndlthtffnpdregwllklggrvktwkrrwfiltdncl
    yyfeyttdkeprgiiplenlsirevedprkpncfelynpshkgqvikackteadgrvveg
    nhvvyrisapspeekeewmksikasisrdpfydmlatrkrria
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r0dB (B:)
    mghhhhhhgsttqrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgegln
    ktvigdylgerddfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeaf
    asryclcnpgvfqstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlp
    eellrnlyesiknepfkipeddgndlthtffnpdregwllklggrvktwkrrwfiltdnc
    lyyfeyttdkeprgiiplenlsirevedprkpncfelynpshkgqvikackteadgrvve
    gnhvvyrisapspeekeewmksikasisrdpfydmlatrkrriankk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0dB (B:)
    ghhhhhhgsttqrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgeglnk
    tvigdylgerddfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeafa
    sryclcnpgvfqstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlpe
    ellrnlyesiknepfkipeddgndlthtffnpdregwllklggrvktwkrrwfiltdncl
    yyfeyttdkeprgiiplenlsirevedprkpncfelynpshkgqvikackteadgrvveg
    nhvvyrisapspeekeewmksikasisrdpfydmlatrkrr