PDB entry 2r0b

View 2r0b on RCSB PDB site
Description: Crystal structure of human tyrosine phosphatase-like serine/threonine/tyrosine-interacting protein
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, PHOSPHATASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Hydrolase, Protein phosphatase
Deposited on 2007-08-18, released 2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine/tyrosine-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: STYX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2r0ba_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0bA (A:)
    slrremqeilpglflgpyssamksklpvlqkhgithiicirqnieanfikpnfqqlfryl
    vldiadnpveniirffpmtkefidgslqmggkvlvhgnagisrsaafviayimetfgmky
    rdafayvqerrfcinpnagfvhqlqeyeaiylak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0bA (A:)
    rremqeilpglflgpyssamksklpvlqkhgithiicirqnieanfikpnfqqlfrylvl
    diadnpveniirffpmtkefidgslqmggkvlvhgnagisrsaafviayimetfgmkyrd
    afayvqerrfcinpnagfvhqlqeyeaiyla