PDB entry 2qzy

View 2qzy on RCSB PDB site
Description: The structure of chicken mitochondrial PEPCK in complex with PEP
Class: lyase
Keywords: pepck, kinase, Decarboxylase, Gluconeogenesis, GTP-binding, Lyase, Manganese, Mitochondrion, Nucleotide-binding, Transit peptide
Deposited on 2007-08-17, released 2007-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21642 (0-607)
      • insertion (95)
      • see remark 999 (96)
      • see remark 999 (199)
      • see remark 999 (234)
      • see remark 999 (305)
      • see remark 999 (468)
      • see remark 999 (97)
    Domains in SCOPe 2.07: d2qzya1, d2qzya2
  • Chain 'B':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21642 (0-607)
      • insertion (95)
      • see remark 999 (96)
      • see remark 999 (199)
      • see remark 999 (234)
      • see remark 999 (305)
      • see remark 999 (468)
      • see remark 999 (97)
    Domains in SCOPe 2.07: d2qzyb1, d2qzyb2
  • Heterogens: MN, PEP, EPE, 20S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qzyA (A:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagryl
    ehwlstglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptp
    igwvpkegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaeleg
    leervrkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qzyA (A:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrslmhdpfamrpffgynagrylehwlstglrsna
    rlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvpkegdldl
    gglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleervrkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qzyB (B:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagryl
    ehwlstglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptp
    igwvpkegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaeleg
    leervrkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qzyB (B:)
    lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
    wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
    magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
    svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
    aqqqgwlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiaw
    mkfddegrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgld
    eptepgvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifg
    grrprgvplvveafgwrhgvfmgsamrselmhdpfamrpffgynagrylehwlstglrsn
    arlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvpkegdld
    lgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleervrkm