PDB entry 2qzx

View 2qzx on RCSB PDB site
Description: Secreted aspartic proteinase (Sap) 5 from Candida albicans
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic proteinase, Candida albicans, Aspartyl protease, Cleavage on pair of basic residues, Glycoprotein, Protease, Secreted, Zymogen, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2007-08-17, released 2008-07-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Candidapepsin-5
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qzxa_
  • Chain 'B':
    Compound: Candidapepsin-5
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qzxb_
  • Chain 'C':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 2QZX (0-5)
  • Chain 'D':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 2QZX (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qzxA (A:)
    gpvavtlhneaitytaditvgsdnqklnvivdtgssdlwipdsnvicipkwrgdkgdfck
    sagsyspassrtsqnlntrfdikygdgsyakgklykdtvgiggvsvrdqlfanvwstsar
    kgilgigfqsgeatefdydnlpislrnqgiigkaayslylnsaeastgqiifggidkaky
    sgslvdlpitsekkltvglrsvnvrgrnvdantnvlldsgttisyftrsivrnilyaiga
    qmkfdsagnkvyvadcktsgtidfqfgnnlkisvpvseflfqtyytsgkpfpkcevrire
    sednilgdnflrsayvvynlddkkismapvkytsesdivain
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qzxB (B:)
    gpvavtlhneaitytaditvgsdnqklnvivdtgssdlwipdsnvicipkwrgdkgdfck
    sagsyspassrtsqnlntrfdikygdgsyakgklykdtvgiggvsvrdqlfanvwstsar
    kgilgigfqsgeatefdydnlpislrnqgiigkaayslylnsaeastgqiifggidkaky
    sgslvdlpitsekkltvglrsvnvrgrnvdantnvlldsgttisyftrsivrnilyaiga
    qmkfdsagnkvyvadcktsgtidfqfgnnlkisvpvseflfqtyytsgkpfpkcevrire
    sednilgdnflrsayvvynlddkkismapvkytsesdivain
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.