PDB entry 2qzw

View 2qzw on RCSB PDB site
Description: Secreted aspartic proteinase (Sap) 1 from Candida albicans
Class: hydrolase
Keywords: aspartic proteinase, Candida albicans, Aspartyl protease, Cleavage on pair of basic residues, Glycoprotein, Hydrolase, Protease, Secreted, Zymogen
Deposited on 2007-08-17, released 2008-07-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Candidapepsin-1
    Species: Candida albicans
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qzwa_
  • Chain 'B':
    Compound: Candidapepsin-1
    Species: Candida albicans
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qzwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qzwA (A:)
    qaipvtlnnehvsyaaditigsnkqkfnvivdtgssdlwvpdasvtcdkprpgqsadfck
    gkgiytpkssttsqnlgtpfyigygdgsssqgtlykdtvgfggasitkqvfaditktsip
    qgilgigyktneaagdydnvpvtlknqgviaknayslylnspnaatgqiifggvdkakys
    gsliavpvtsdrelritlnslkavgkningnidvlldsgttitylqqdvaqdiidafqae
    lksdgqghtfyvtdcqtsgtvdfnfdnnakisvpaseftaplsyangqpypkcqlllgis
    danilgdnflrsaylvydldddkislaqvkytsasniaalt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qzwB (B:)
    qaipvtlnnehvsyaaditigsnkqkfnvivdtgssdlwvpdasvtcdkprpgqsadfck
    gkgiytpkssttsqnlgtpfyigygdgsssqgtlykdtvgfggasitkqvfaditktsip
    qgilgigyktneaagdydnvpvtlknqgviaknayslylnspnaatgqiifggvdkakys
    gsliavpvtsdrelritlnslkavgkningnidvlldsgttitylqqdvaqdiidafqae
    lksdgqghtfyvtdcqtsgtvdfnfdnnakisvpaseftaplsyangqpypkcqlllgis
    danilgdnflrsaylvydldddkislaqvkytsasniaalt