PDB entry 2qzq

View 2qzq on RCSB PDB site
Description: Crystal structure of C-terminal of Aida
Deposited on 2007-08-17, released 2008-09-23
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Axin interactor, dorsalization associated protein
    Species: Danio rerio [TaxId:7955]
    Gene: Aida
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2qzqA (A:)
    gsllprlpsepgmtlltltiekiglkdagqcidpyitvsvkdlngidlnpvqdtpvatrk
    edtyihfsvdveiqrhleklpkgaaiffefkhykpkkrftstkcfafmemdeikpgpivi
    elykkptdfkrkklnlltkkplylhlnqtlhk