PDB entry 2qzl

View 2qzl on RCSB PDB site
Description: Crystal Structure of human Beta Secretase complexed with IXS
Class: hydrolase
Keywords: ASPARTYL PROTEASE, BACE, Alternative splicing, Glycoprotein, Hydrolase, Membrane, Transmembrane, Zymogen
Deposited on 2007-08-16, released 2008-04-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817 (Start-410)
      • engineered (100)
      • engineered (102)
    Domains in SCOPe 2.04: d2qzla_
  • Heterogens: IXS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qzlA (A:)
    rgsfvemlpretdeepeepgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtg
    ssnfavgaaphpflhryyqrqlsstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvt
    vraniaaitesdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslql
    cgagfplnqsevlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlk
    mdckeynydksivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagt
    tpwnifpvislylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmg
    avimegfyvvfdrarkrigfavsachvhdefrtaavegpfvtldmedcgyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qzlA (A:)
    rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
    lsstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvtvraniaaitesdkffingsnw
    egilglayaeiarpddslepffdslvkqthvpnlfslqlcgasvggsmiiggidhslytg
    slwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavk
    sikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqyl
    rpvesqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaav
    egpfvtldmedcgyn