PDB entry 2qzh

View 2qzh on RCSB PDB site
Description: SCR2/3 of DAF from the NMR structure 1nwv fitted into a cryoEM reconstruction of CVB3-RD complexed with DAF
Class: immune system
Keywords: SCR2-3 of DAF fitted into cryoEM density of CVB3-RD complexed with DAF, Alternative splicing, Blood group antigen, Complement pathway, Glycoprotein, GPI-anchor, Immune response, Innate immunity, Lipoprotein, Membrane, Polymorphism, Sushi, Immune system
Deposited on 2007-08-16, released 2007-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: 14 Å
R-factor: N/A
AEROSPACI score: -0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: complement decay-accelerating factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08174 (1-127)
    • insertion (0)
    • insertion (128)
  Domains in SCOPe 2.08: d2qzha1, d2qzha2, d2qzha3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qzhA (A:)
  frscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwsta
  vefckkkscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqws
  dplpecreh