PDB entry 2qzf

View 2qzf on RCSB PDB site
Description: SCR1 of DAF from 1ojv fitted into cryoEM density
Class: Immune system
Keywords: SCR1 of DAF from structure 1ojv fitted into cryoEM density, Blood group antigen, Complement pathway, Glycoprotein, GPI-anchor, Immune response, Innate immunity, Lipoprotein, Membrane, Sushi, Immune system
Deposited on 2007-08-16, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: EM
Resolution: 14 Å
R-factor: N/A
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: complement decay-accelerating factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08174 (2-61)
    • insertion (0-1)
  Domains in SCOPe 2.07: d2qzfa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qzfA (A:)
  mqdcglppdvpnaqpalegrtsfpedtvitykceesfvkipgekdsviclkgsqwsdiee
  fc