PDB entry 2qzd

View 2qzd on RCSB PDB site
Description: Fitted structure of SCR4 of DAF into cryoEM density
Class: immune system
Keywords: SCR4 of DAF from 1ojv fitted into cryoEM density, Blood group antigen, Complement pathway, Glycoprotein, GPI-anchor, Immune response, Innate immunity, Lipoprotein, Membrane, Sushi, IMMUNE SYSTEM
Deposited on 2007-08-16, released 2007-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: 14 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: complement decay-accelerating factor
  Species: Homo sapiens [TaxId:9606]
  Gene: CD55, CR, DAF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08174 (0-63)
    • insertion (64)
  Domains in SCOPe 2.08: d2qzda1, d2qzda2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qzdA (A:)
  eiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgppp
  ecrgc