PDB entry 2qyw

View 2qyw on RCSB PDB site
Description: Crystal structure of mouse vti1b Habc domain
Deposited on 2007-08-15, released 2007-11-27
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vesicle transport through interaction with t-SNAREs 1B homolog
    Species: Mus musculus [TaxId:10090]
    Gene: Vti1b
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2qywA (A:)
    gspgihmaasaassehfeklheifrglledlqgvperllgtagteekkklvrdfdekqqe
    anetlaemeeelryapltfrnpmmsklrnyrkdlaklhrevr
    

    Sequence, based on observed residues (ATOM records):
    >2qywA (A:)
    maasaassehfeklheifrglledlqgvperllgtagteekkklvrdfdekqqeanetla
    emeeelryapltfrnpmmsklrnyrkdlaklhrevr