PDB entry 2qyu

View 2qyu on RCSB PDB site
Description: Crystal structure of Salmonella effector protein SopA
Deposited on 2007-08-15, released 2007-12-11
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secreted effector protein
    Species: Salmonella typhimurium [TaxId:216597]
    Gene: sopA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, B3P, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2qyuA (A:)
    mhhhhhhatsspsspadwakkltdavlrqkagetltaadrdfsnadfrnitfskilppsf
    merdgdiikgfnfsnskftysdishlhfdecrftystlsdvvcsntkfsnsdmnevflqy
    sittqqqpsfidttlkntlirhkanlsgvilnepdnssppsvsgggnfirlgdiwlqmpl
    lwtenavdgflnhehnngksilmtidslpdkysqekvqamedlvkslrggrlteacirpv
    esslvsvlahppytqsalisewlgpvqerffahqcqtyndvplpapdtyyqqrilpvlld
    sfdrnsaamtthsglfnqvilhcmtgvdctdgtrqkaaalyeqylahpavsphihnglfg
    nydgspdwttraadnflllssqdsdtammlstdtlltmlnptpdtawdnfyllragenvs
    taqispvelfrhdfpvflaafnqqatqrrfgelidiilsteehgelnqqflaatnqkhst
    vkliddasvsrlatifdpllpegklspahyqhilsayhltdatpqkqaetlfclstafar
    ysssaifgtehdsppalrgyaealmqkawelspaifpsseqftewsdrfhglhgaftcts
    vvadsmqrharkyfpsvlssilplawa
    

    Sequence, based on observed residues (ATOM records):
    >2qyuA (A:)
    atsspsspadwakkltdavlrqkagetltaadrdfsnadfrnitfskilppsfmerdgdi
    ikgfnfsnskftysdishlhfdecrftystlsdvvcsntkfsnsdmnevflqysittqqq
    psfidttlkntlirhkanlsgvilnepdnssppsvsgggnfirlgdiwlqmpllwtenav
    dgflnhehnngksilmtidslpdkysqekvqamedlvkslrggrlteacirpvesslvsv
    lahppytqsalisewlgpvqerffahqcqtyndvplpapdtyyqqrilpvlldsfdrnsa
    amtthsglfnqvilhcmtgvdctdgtrqkaaalyeqylahpavsphihnglfgnydgspd
    wttraadnflllssqdsdtammlstdtlltmlnptpdtawdnfyllragenvstaqispv
    elfrhdfpvflaafnqqatqrrfgelidiilsteehgelnqqflaatnqkhstvklidda
    svsrlatifdpllpegklspahyqhilsayhltdatpqkqaetlfclstafarysssaif
    gtehdsppalrgyaealmqkawelspaifpsseqftewsdrfhglhgaftctsvvadsmq
    rharkyfpsvlssilplawa