PDB entry 2qyt

View 2qyt on RCSB PDB site
Description: Crystal structure of 2-dehydropantoate 2-reductase from Porphyromonas gingivalis W83
Deposited on 2007-08-15, released 2007-09-04
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydropantoate 2-reductase
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: panE, PG_2205
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2qytA (A:)
    snamnqqpikiavfglggvggyygamlalraaatdgllevswiargahleairaagglrv
    vtpsrdflarptcvtdnpaevgtvdyilfctkdydmergvaeirpmigqntkilpllnga
    diaermrtylpdtvvwkgcvyisarksapglitleadrelfyfgsglpeqtddevrlael
    ltaagiraynptdidwyimkkfmmisvtatatayfdkpigsiltehepellslleevael
    frakygqvpddvvqqlldkqrkmppestssmhsdflqggstevetltgyvvreaealrvd
    lpmykrmyrelvsrtan
    

    Sequence, based on observed residues (ATOM records):
    >2qytA (A:)
    qpikiavfglggvggyygamlalraaatdgllevswiargahleairaagglrvvtpsrd
    flarptcvtdnpaevgtvdyilfctkdydmergvaeirpmigqntkilpllngadiaerm
    rtylpdtvvwkgcvyisarksapglitleadrelfyfgsglpeqtddevrlaelltaagi
    raynptdidwyimkkfmmisvtatatayfdkpigsiltehepellslleevaelfrakyg
    qvpddvvqqlldkqrkmetltgyvvreaealrvdlpmykrmyrelvs