PDB entry 2qyn

View 2qyn on RCSB PDB site
Description: Crystal structure of PDE4D2 in complex with inhibitor NPV
Class: hydrolase
Keywords: PDE4D selective inhibitor NVP, Alternative splicing, cAMP, Cytoplasm, Cytoskeleton, Hydrolase, Membrane, Metal-binding, Phosphorylation
Deposited on 2007-08-15, released 2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.225
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qyna_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qynb_
  • Heterogens: NPV, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qynA (A:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qynA (A:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qynB (B:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qynB (B:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
    vhpdaqdildtlednrewyqstipq