PDB entry 2qyi

View 2qyi on RCSB PDB site
Description: Crystal structure of a binary complex between an engineered trypsin inhibitor and Bovine trypsin
Class: Hydrolase/Hydrolase inhibitor
Keywords: P1 mutant, trypsin inhibitor, bovine trypsin, complex, Calcium, Digestion, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Protease inhibitor, Serine protease inhibitor, Hydrolase/Hydrolase inhibitor COMPLEX
Deposited on 2007-08-15, released 2008-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qyia_
  • Chain 'B':
    Compound: Chymotrypsin inhibitor 3
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10822
      • engineered (64)
    Domains in SCOPe 2.06: d2qyib_
  • Chain 'C':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qyic_
  • Chain 'D':
    Compound: Chymotrypsin inhibitor 3
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10822 (0-End)
      • engineered (64)
    Domains in SCOPe 2.06: d2qyid_
  • Heterogens: CA, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qyiA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qyiB (B:)
    dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
    ssqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
    kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
    ssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyiB (B:)
    dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
    ssqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
    kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qyiC (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qyiD (D:)
    dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
    ssqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
    kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
    ssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyiD (D:)
    dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
    ssqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
    kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka