PDB entry 2qyh

View 2qyh on RCSB PDB site
Description: Crystal structure of the hypothetical protein (gk1056) from geobacillus kaustophilus HTA426
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-08-15, released 2008-08-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical conserved protein, GK1056
    Species: Geobacillus kaustophilus [TaxId:1462]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qyha_
  • Chain 'B':
    Compound: Hypothetical conserved protein, GK1056
    Species: Geobacillus kaustophilus [TaxId:1462]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qyhb_
  • Chain 'C':
    Compound: Hypothetical conserved protein, GK1056
    Species: Geobacillus kaustophilus [TaxId:1462]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qyhc_
  • Chain 'D':
    Compound: Hypothetical conserved protein, GK1056
    Species: Geobacillus kaustophilus [TaxId:1462]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qyhd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qyhA (A:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqlir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyhA (A:)
    grkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgids
    fvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphihv
    smaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpag
    gskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtkp
    vdkegiwyglkqlqli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qyhB (B:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqlir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qyhC (C:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqlir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyhC (C:)
    grkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgids
    fvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphihv
    smaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpag
    gskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtkp
    vdkegiwyglkqlqli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qyhD (D:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqlir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyhD (D:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqli