PDB entry 2qyf

View 2qyf on RCSB PDB site
Description: Crystal structure of the Mad2/p31(comet)/Mad2-binding peptide ternary complex
Class: cell cycle
Keywords: PROTEIN-PEPTIDE COMPLEX, MAD2 FAMILY, SPINDLE ASSEMBLY CHECKPOINT, Cell cycle, Cell division, Mitosis, Nucleus, Phosphorylation
Deposited on 2007-08-14, released 2008-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitotic spindle assembly checkpoint protein mad2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1, MAD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257 (Start-205)
      • engineered (13)
    Domains in SCOPe 2.08: d2qyfa_
  • Chain 'B':
    Compound: MAD2L1-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1BP, CMT2, KIAA0110
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: mitotic spindle assembly checkpoint protein mad2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1, MAD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257 (Start-205)
      • engineered (13)
    Domains in SCOPe 2.08: d2qyfc_
  • Chain 'D':
    Compound: MAD2L1-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1BP, CMT2, KIAA0110
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2QYF (0-End)
  • Chain 'F':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2QYF (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qyfA (A:)
    gmalqlsreqgitargsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdl
    elikylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsaprek
    sqkaiqdeirsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnse
    evrlrsftttihkvnsmvaykipvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyfA (A:)
    qgitargsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnv
    veqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdei
    rsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftt
    tihkvnsmvaykipvnd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qyfC (C:)
    gmalqlsreqgitargsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdl
    elikylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsaprek
    sqkaiqdeirsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnse
    evrlrsftttihkvnsmvaykipvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyfC (C:)
    targsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvveq
    lkdwlykcsvqklvvvisniesgevlerwqfdiecdksqkaiqdeirsvirqitatvtfl
    pllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftttihkvnsmvaykip
    vnd
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.