PDB entry 2qxx

View 2qxx on RCSB PDB site
Description: Bifunctional dCTP deaminase: dUTPase from Mycobacterium tuberculosis in complex with dTTP
Class: hydrolase
Keywords: distorted beta barrel, Hydrolase, Nucleotide metabolism
Deposited on 2007-08-13, released 2008-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qxxa_
  • Chain 'B':
    Compound: deoxycytidine triphosphate deaminase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: dcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qxxb_
  • Heterogens: MG, TTP, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qxxA (A:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxxA (A:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qxxB (B:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirst
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxxB (B:)
    mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
    tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
    gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
    rsyqnfirs