PDB entry 2qxt

View 2qxt on RCSB PDB site
Description: Crystal Structure Analysis of the Bacillus subtilis lipase crystallized at pH 4.5
Class: hydrolase
Keywords: alpha/beta hydrolase fold, Lipid degradation, Secreted, HYDROLASE
Deposited on 2007-08-13, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: LIPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qxta_
  • Chain 'B':
    Compound: Lipase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: LIPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qxtb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qxtA (A:)
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qxtB (B:)
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn