PDB entry 2qxs

View 2qxs on RCSB PDB site
Description: Crystal Structure of Antagonizing Mutant 536S of the Estrogen Receptor Alpha Ligand Binding Domain Complexed to Raloxifene
Class: transcription
Keywords: Protein-Ligand Complex, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphorylation, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc-finger
Deposited on 2007-08-12, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (239)
    Domains in SCOPe 2.07: d2qxsa_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (239)
    Domains in SCOPe 2.07: d2qxsb_
  • Heterogens: RAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qxsA (A:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvps
    ydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxsA (A:)
    lalsltadqmvsalldaeppilyseydprpfsasmmglltnladrelvhminwakrvpgf
    vdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdm
    llatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlm
    akagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemldah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qxsB (B:)
    sikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvps
    ydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxsB (B:)
    lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
    dqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllatss
    rfrmmnlqgeefvclksiillnsgvyleekdhihrvldkitdtlihlmakagltlqqqhq
    rlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemldahr