PDB entry 2qxh

View 2qxh on RCSB PDB site
Description: Crystal Structure of Human Kallikrein 7 in Complex with Suc-Ala-Ala-Pro-Phe-chloromethylketone
Class: hydrolase
Keywords: 70-80 loop, active site inhibitor, chloromethyl ketone, Alternative splicing, Glycoprotein, Hydrolase, Protease, Secreted, Serine protease, Zymogen
Deposited on 2007-08-11, released 2008-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-7
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK7, PRSS6, SCCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qxha_
  • Heterogens: K7J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qxhA (A:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkkhr