PDB entry 2qxa

View 2qxa on RCSB PDB site
Description: Human p53 Core Domain Mutant V157F
Class: apoptosis
Keywords: p53; apoptosis; cancer mutation; crystal structure, Activator, Anti-oncogene, Cell cycle, Disease mutation, DNA-binding, Endoplasmic reticulum, Glycoprotein, Host-virus interaction, Li-Fraumeni syndrome, Metal-binding, Nucleus, Phosphorylation, Transcription, Transcription regulation, APOPTOSIS
Deposited on 2007-08-10, released 2008-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.243
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (Start-194)
      • engineered mutation (62)
    Domains in SCOPe 2.08: d2qxaa_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (Start-194)
      • engineered mutation (62)
    Domains in SCOPe 2.08: d2qxab_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-194)
      • engineered mutation (62)
    Domains in SCOPe 2.08: d2qxac_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (Start-194)
      • engineered mutation (62)
    Domains in SCOPe 2.08: d2qxad_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qxaA (A:)
    ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
    trframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
    svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
    cacpgrdrrteeenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxaA (A:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qxaB (B:)
    ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
    trframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
    svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
    cacpgrdrrteeenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxaB (B:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeenl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qxaC (C:)
    ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
    trframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
    svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
    cacpgrdrrteeenl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qxaD (D:)
    ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
    trframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
    svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
    cacpgrdrrteeenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxaD (D:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeenl