PDB entry 2qwj

View 2qwj on RCSB PDB site
Description: the x-ray structure of a complex of 5-n-acetyl-4-amino-6-diethylcarboxamide-4,5-dihydro-2h-pyran-2-carboxylic acid and a drug resistant variant r292k of tern n9 influenza virus neuraminidase
Deposited on 1998-04-07, released 1998-11-11
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-11, with a file datestamp of 1998-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2qwj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qwj_ (-)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl