PDB entry 2qwj

View 2qwj on RCSB PDB site
Description: the x-ray structure of a complex of 5-n-acetyl-4-amino-6-diethylcarboxamide-4,5-dihydro-2h-pyran-2-carboxylic acid and a drug resistant variant r292k of tern n9 influenza virus neuraminidase
Class: hydrolase
Keywords: neuraminidase, influenza protein, drug resistant variant, sialic acid analogues, dana anologues, glycosylated protein, hydrolase, carboxamide derivatives
Deposited on 1998-04-07, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qwja_
  • Heterogens: NAG, CA, G28, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qwjA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl