PDB entry 2qw4

View 2qw4 on RCSB PDB site
Description: Human NR4A1 ligand-binding domain
Class: hormone receptor
Keywords: NUCLEAR RECEPTOR, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, DNA-binding, Metal-binding, Nucleus, Phosphorylation, Transcription, Transcription regulation, Zinc-finger, HORMONE RECEPTOR
Deposited on 2007-08-09, released 2007-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orphan nuclear receptor NR4A1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qw4a1
  • Chain 'B':
    Compound: Orphan nuclear receptor NR4A1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qw4b_
  • Chain 'C':
    Compound: Orphan nuclear receptor NR4A1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qw4c_
  • Chain 'D':
    Compound: Orphan nuclear receptor NR4A1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qw4d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qw4A (A:)
    mgsshhhhhhssglvprgshmgrlpskpkqppdaspanlltslvrahldsgpstakldys
    kfqelvlphfgkedagdvqqfydllsgslevirkwaekipgfaelspadqdlllesafle
    lfilrlayrskpgegklifcsglvlhrlqcargfgdwidsilafsrslhsllvdvpafac
    lsalvlitdrhglqeprrveelqnriasclkehvaavagepqpasclsrllgklpelrtl
    ctqglqrifylkledlvppppiidkifmdtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qw4A (A:)
    nlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwae
    kipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdw
    idsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaav
    agpasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qw4B (B:)
    mgsshhhhhhssglvprgshmgrlpskpkqppdaspanlltslvrahldsgpstakldys
    kfqelvlphfgkedagdvqqfydllsgslevirkwaekipgfaelspadqdlllesafle
    lfilrlayrskpgegklifcsglvlhrlqcargfgdwidsilafsrslhsllvdvpafac
    lsalvlitdrhglqeprrveelqnriasclkehvaavagepqpasclsrllgklpelrtl
    ctqglqrifylkledlvppppiidkifmdtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qw4B (B:)
    nlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwae
    kipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdw
    idsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaav
    agpasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qw4C (C:)
    mgsshhhhhhssglvprgshmgrlpskpkqppdaspanlltslvrahldsgpstakldys
    kfqelvlphfgkedagdvqqfydllsgslevirkwaekipgfaelspadqdlllesafle
    lfilrlayrskpgegklifcsglvlhrlqcargfgdwidsilafsrslhsllvdvpafac
    lsalvlitdrhglqeprrveelqnriasclkehvaavagepqpasclsrllgklpelrtl
    ctqglqrifylkledlvppppiidkifmdtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qw4C (C:)
    panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
    aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
    dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
    avclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qw4D (D:)
    mgsshhhhhhssglvprgshmgrlpskpkqppdaspanlltslvrahldsgpstakldys
    kfqelvlphfgkedagdvqqfydllsgslevirkwaekipgfaelspadqdlllesafle
    lfilrlayrskpgegklifcsglvlhrlqcargfgdwidsilafsrslhsllvdvpafac
    lsalvlitdrhglqeprrveelqnriasclkehvaavagepqpasclsrllgklpelrtl
    ctqglqrifylkledlvppppiidkifmdtlpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qw4D (D:)
    nlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwae
    kipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdw
    idsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaav
    sclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtl