PDB entry 2qvi

View 2qvi on RCSB PDB site
Description: Crystal structure of N-cadherin domains EC12
Class: cell adhesion
Keywords: beta barrel, strand swap, domain swap, Calcium, Cell adhesion, Cleavage on pair of basic residues, Glycoprotein, Membrane, Phosphoprotein, Transmembrane
Deposited on 2007-08-08, released 2008-08-12
The last revision prior to the SCOP 1.75 freeze date was dated 2008-08-12, with a file datestamp of 2008-08-08.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.254
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-2
    Species: MUS MUSCULUS
    Gene: CDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qvia1, d2qvia2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qviA (A:)
    dwvippinlpensrgpfpqelvrirsdrdknlslrysvtgpgadqpptgifiinpisgql
    svtkpldreliarfhlrahavdingnqvenpidivinvidmndnrpeflhqvwngsvpeg
    skpgtyvmtvtaidaddpnalngmlryrilsqapstpspnmftinnetgdiitvaagldr
    ekvqqytliiqatdmegnptyglsntatavitvtd