PDB entry 2qv4

View 2qv4 on RCSB PDB site
Description: Human pancreatic alpha-amylase complexed with nitrite and acarbose
Class: hydrolase
Keywords: AMYLASE, PICHIA PASTORIS, GLYCOSYLATED PROTEIN, MUTAGENESIS, DIABETES, CATALYSIS, PANCREATIC, ENZYME, HUMAN, HYDROLASE, ANION ACTIVATION, NITRITE, CHLORIDE, ACARBOSE, TRANSGLYCOSYLATION, Carbohydrate metabolism, Glycoprotein, Glycosidase, Metal-binding, Pyrrolidone carboxylic acid, Secreted
Deposited on 2007-08-07, released 2008-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pancreatic alpha-amylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AMY2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04746 (0-495)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d2qv4a1, d2qv4a2
  • Heterogens: NAG, CA, NO2, QV4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qv4A (A:)
    eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl