PDB entry 2quz

View 2quz on RCSB PDB site
Description: Crystal Structure of the activating H-RasK117R mutant in Costello Syndrome, bound to Mg-GDP
Class: signaling protein, hydrolase
Keywords: HYDROLASE, GTPase protein, Costello Syndrome, Ras protein, SIGNALING PROTEIN
Deposited on 2007-08-07, released 2007-12-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.204
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (116)
    Domains in SCOPe 2.01: d2quza_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2quzA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnrcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh